Home ProductsGrowth Hormone Peptides

Long R3 IGF-1 Growth Hormone Releasing Peptide

Good quality Body Building Steroids for sales
Good quality Body Building Steroids for sales
have cooperated with biopro for years and I was invited to say something here. most professional packing, highest quality and best service!

—— Alexander Gaus

Biopro is awesome!!!!!My representative is very polite and keep me current with new promotions.Their powders I ordered are giving me very good result!

—— Oleg M

You guys are soooo fast communication and good quality. will definitely get back with more orders.

—— susan Rustiguel

I order with biopro for a long time and can say they are more gentle and attentive seller who you can make an order.

—— Holly Shane

The quality is sooo stable while order from your guys these years,it is amazing quality ,I will never change my source cos it bring me good feedback!!

—— Alex Clinton

Long R3 IGF-1 Growth Hormone Releasing Peptide

China Long R3 IGF-1 Growth Hormone Releasing Peptide supplier

Large Image :  Long R3 IGF-1 Growth Hormone Releasing Peptide

Product Details:

Place of Origin: China
Brand Name: Biopro
Certification: GMP/HACCP/ISO
Model Number: PEP-114

Payment & Shipping Terms:

Minimum Order Quantity: 1 box
Price: USD1~100/Box
Packaging Details: 10 vials/box
Delivery Time: Immediate Shipping
Payment Terms: T/T, Western Union, MoneyGram
Supply Ability: 1000 boxes per week
Detailed Product Description
Product Name: IGF-1 LR3 Other Name: Long R3 IGF-1
Chemical Name: Long Arg3 IGF-1 Abbreviation: LR3 IGF
CAS No.: 946870-92-4 Molecular Formula: C400H625N111O115S9
Product Type: Lyophillized Powder Package: 0.1 Mg/vial

Growth Hormone Peptides IGF - 1 LR3 Lyophilized Peptide Long R3 IGF - 1 for Bodybuilding

 

  • Description

    IGF-1 LR3, also known as Long-Arginine-3-IGF-1, is an analogue of human IGF-1 that has been modified to include a 13 amino acid N-terminus extension and the substitution of Arginine for Glutamic Acid at position 3. As a result of these modifications, IGF-1 LR3 is approximately three times more potent than IGF-1 and possesses an increased half-life due to lowered affinity for binding to the Insulin-Like Growth Factor-Binding Proteins (IGFBPs). IGF-1 LR3 retains the ability to bind agonistically to the IGF-1 receptor with improved metabolic stability, relative to IGF-1. The supplementation of mammalian cell cultures with Long R3 IGF-1 at a much lower concentration results in more highly elevated productivity than with standard concentrations of insulin and/or standard IGF-1. IGF-1 LR3 is more able to stimulate the type 1 IGF receptor and thus induce a higher level of activation of intracellular signaling, which is responsible for promoting cell proliferation and the inhibition of apoptosis.
     
  • Specification

    Name: IGF-1 LR3
    Synonyms: Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1
    CAS No.: 946870-92-4
    Molecular Formula: C400H625N111O115S9
    Molecular Mass: 9117.5 Da (g/mol)
    Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
    Structure:
    Long R3 IGF-1 Growth Hormone Releasing Peptide

     
  • Purity

    IGF-1 LR3 has a peptide purity level that exceeds 95.0% as determined by HPLC and MS.


     
  • Application Information

    The polypeptide Long R3 Insulin-like Growth Factor-I (IGF1 LR3) is an 83 amino acid analog of IGF-I actually comprising the complete IGF-1 sequence but with the substitution of an Arginine (Arg) for the Glutamic Acid (Glu) at position 3, as well as a 13 amino acid extension peptide. This sequence change causes IGF-1 LR3 to avoid binding to proteins and allow it to have a much longer half life, around 20-30 hours. This analog of IGF-1 has been produced with the purpose of increasing the biological activity of the IGF peptide.” IGF stands for insulin-like growth factor. Among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, and decreased protein degradation. When IGF is active it behaves differently in different types of tissues. In muscle cells proteins and associated cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 LR3 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF-1 LR3 prevents insulin from transporting glucose across cell membranes. As a result the cells have to switch to burning off fat as a source of energy.

    IGF-1 LR3 builds new muscle tissue by promoting nitrogen retention and protein synthesis. This causes the growth of muscles through both hyperplasia (which is an increase in number of muscle cells) and mitogenesis (which is the actual growth of new muscle fibers). Thus IGF-1 LR3 not only makes muscle fibers bigger, it makes more of them as well. Therefore, IGF can actually change the genetic capabilities in terms of muscle tissue and cell count. IGF increases and differentiates the number and types of cells present.

    IGF-1 LR3 is a synthetic analog of the naturally existing insulin growth factor (IGF) which is a 93 amino acid residue. Modifications of the natural form occurred with the substitution of the Arg with Glu at the position 3, giving a code R3, and also an extension of a 13 amino acid at the B-terminus. Just like IGF-1, R3 has been shown to induce the development and growth of cells.

    The studies on transgenic and knockout mice have shown that it can control its development and growth. It plays an important role as regulator in the G1 to S phase of the cell cycle. When applied to cardiomyocyte cultures, R3 have shown a large increase in proliferating cell nuclear antigen expression and in several cyclins involved in cell progression as well as in bromodeoxyuridien (BrdU) labeling (Kajstura et al. 1994). Other effects it has on cell lines are increased cell survival, inhibition of the apoptotic pathways, culture longevity and increased recombination of protein production (Fang et al. 1997). In another study, the application of the LR3 IGF-1 has led to an increase in the myocyte bromodeoxyuridine uptake by three to fivefold. But it has also shown that IGF-1 LR3 actions have been blocked by the ERK and P13K labeling which completely abolished the BrdU uptake. Furthermore, ut has been shown that in mycocytes, IGF-1 R3 stimulates the cardiomyocyte division in vivo (Sundgren et al. 2003). It has also been suggested that IGF-1-Long 3R is more potent than the IGF-1 because of its low binding capacity with all known IGF binding proteins (Tomas et al. 1995). In another investigation, feeding of LR3-IGF-1 in different amounts to investigate the effects on somatotropic axis (plasma levels of IGF-1 and 2, IGFBPs) was done. They have reported that plasma Long-R3 increased when administered subcutaneously but with no such behavior when administered orally. Furthermore, LR3 lowered the levels of native IGF-1 in rbGH-injected in calves, but L-R3 increased the amounts of IGF-II concentrations when administered with L-R3 subcutaneously. The parenteral administration of the Long R3 IGF-1 decreased the growth hormone concentration but did not affect the secretory system. It was also reported that the somatotrophic acis is basically functioning in neonatal calves and can be influenced by nutrition, growth hormone and Long-R3-IGF-1 (IGF1-LR3). (Hammon and Blum 1997).

    It has a considerably longer half-life than other form, nearly 20-30 hours. When IGF-1 LR3 is active, has multiple effects on tissues in muscle cells. It plays a essential role in muscle renewal. IGF-1 LR3 encourages both increase as well distinction of stem cells. IGF-1 LR3 increases satellite cell activity, muscle DNA, muscle protein content, muscle weight and muscle cross sectional area. The importance of IGF-1 LR3 lies in the fact that all of its obvious effects work to induce muscle growth. These effects are enhanced when combined with weight training.

    Protein creation is better along with amino acid absorption as a source of energy. It enhances use of fat as energy. In lean tissue, IGF-1 LR3 prevents insulin form carrying glucose across cell membranes, as a result, the cells have to change to burning off fat as a source of energy. IGF-1 LR3 also mimics insulin in the human body.

    Perhaps the most remarkable also strong influence it has on the human body is its ability to cause hyperplasia, which is an definite splitting of cells. Hypertrophy is what ensues during weight training; it is an increase in the size of muscle cells. Adult humans have a fixed number of muscle cells, that can become larger with training, however the number of muscle sells does not increase. But, with this preparation use you are able to induce hyperplasia which actually increases the number of muscle cells present in the muscle. Research studies show that with weight training the new cells develop faster and become stronger and more dense.

    IGF-1 LR3 plays an important part in childhood growth and continues to have results in adults. It is made in the human body and is at ideal levels during puberty. In most studies, the maximum active length for research studies IGF-1 LR3 is 50 days on also 20-40 days off. The most common range used during clinical research is typically between 20mcg to 120mcg per day.

    During puberty, IGF is the most responsible for the natural muscle growth that occurs during these few years. There are many different things that IGF does in the human body; among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, decreased protein degradation and increased RNA synthesis.

    Perhaps the most interesting and potent effect IGF has on the human body is its ability to cause hyperplasia, which is an actual split-ting of cells.

    In muscle cells, proteins and their cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF prevents insulin from transporting glucose across cell membranes. As a result, the cells have to switch to burning off fat as a source of energy.

    Research Use of IGF-1 LR3
    > enlarged amino acid transporting cells
    > increased protein production
    > reduced protein degradation
    > amplified glucose transporting
    > augmented RNA combination
     
  • Buy IGF-1 LR3 (Long R3 IGF-1) from Biopro for discount on the first order.
     
  • Reference List of Available Peptides
     
    Peptide Specification   Peptide Specification
    ACE-931 1 mg   Semorelin 2 mg
    AOD-9604 5 mg   TB-500 5 mg
    BPC-157 5 mg   Tesamorelin 10 mg
    CJC-1295 DAC 2 mg   Triptorein 2 mg
    CJC-1295 no DAC 2 mg   Melanotan I 10 mg
    Epithalon 10 mg   Melanotan II 10 mg
    FST-344 1 mg   PT-141 10 mg
    Fragment 176-191 5 mg   MGF 2 mg
    GHRP-2 5 mg   PEG-MGF 2 mg
    GHRP-6 5 mg   Selank 5 mg
    Gonadorelin 10 mg   DSIP 2 mg
    Hexarelin 2 mg   IGF-1 LR3 0.1 mg
    Ipamorelin 2 mg   IGF-1 (1-3) 1 mg
    Oxytocin 10 mg   SNAP-8 200 mg

Contact Details
Biopro Chemicals Co., Ltd.

Contact Person: Mr. Johnny

Send your inquiry directly to us (0 / 3000)