Home ProductsGrowth Hormone Peptides

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

Good quality Body Building Steroids for sales
Good quality Body Building Steroids for sales
have cooperated with biopro for years and I was invited to say something here. most professional packing, highest quality and best service!

—— Alexander Gaus

Biopro is awesome!!!!!My representative is very polite and keep me current with new promotions.Their powders I ordered are giving me very good result!

—— Oleg M

You guys are soooo fast communication and good quality. will definitely get back with more orders.

—— susan Rustiguel

I order with biopro for a long time and can say they are more gentle and attentive seller who you can make an order.

—— Holly Shane

The quality is sooo stable while order from your guys these years,it is amazing quality ,I will never change my source cos it bring me good feedback!!

—— Alex Clinton

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

China GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial supplier

Large Image :  GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

Product Details:

Place of Origin: China
Brand Name: Biopro
Certification: GMP,SGS,BV,ISO
Model Number: GHP-37

Payment & Shipping Terms:

Minimum Order Quantity: Negotiation
Price: Negotiation
Packaging Details: 1 mg/vial, 10 vials/box
Delivery Time: Within 24 hours after payment
Payment Terms: Western Union, MoneyGram, T/T
Supply Ability: Mass in stock
Detailed Product Description
Product Name: IGF-1 DES Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3)
Appearance: White Lyophilized Powder Purity: 99%min
Specification: 1 Mg/vial Suitable For: Adult, Bodybuilding
Free Sample: Yes Customs Pass Rate: Guaranteed

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

Basic Info.
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da
Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3)
Compound: Thr-Leu-Cys-Gly-Ala.
Purity: 99.21%


IGF-1DES Dose
DES IGF-1 can be dosed at 50-150mcg multiple times a day (prior to training) into specific target areas. since DES has such a short half life (20-30 minutes), desensitization was not noticed at all . Injection sites should be localized; preferably, at the muscle group you want to grow. In simple terms, if you want to grow your biceps, inject IGF-1DES right into your bicep.

IGF-1DES Half-life
DES IGF-1 is the shorter version of the IGF-1 chain. It is five (5) times more powerful than IGF-1LR3 and ten (10) times more powerful than regular base IGF-1. The half-life for DES is about 20-30 minutes, which means this is a very delicate chain. Therefore, administration should only be done at the site where you want to see muscle growth. DES has the ability to stimulate muscle hyperplasia better than LR3. In simple terms, it's best used for site injections, rather than overall growth.
In addition, DES is known to bind to receptors that have been deformed by lactic acid, which is often present during workouts. This allows the DES to attach itself to a mutated receptor and signal tissue growth during training. DES can be used longer and more frequently than LR3.


Best Sale

Name SPE
Melanotan I 10mg/vial ,10vial/box
Melanotan II 10mg/vial ,10vial/box
CJC 1295 2mg/vial ,10vial/box
cjc1295 dac 2mg/vial ,10vial/box
Sermorelin 2mg/vial ,10vial/box
Sermorelin 5mg/vial ,10vial/box
PT 141 10mg/vial ,10vial/box
Ipamorelin 2mg/vial ,10vial/box
Ipamorelin 5mg/vial ,10vial/box
MGF 2mg/vial ,10vial/box
PEG MGF 2mg/vial ,10vial/box
GHRP-6 5mg/vial ,10vial/box
GHRP-2 5mg/vial ,10vial/box
Hexarelin 2mg/vial ,10vial/box
Hexarelin 5mg/vial ,10vial/box
Thymosin Beta 4 (TB4)(TB-500) 2mg/vial ,10vial/box
Follistatin 344 1mg/vial ,10vial/box
Oxytocin 2mg 2mg/vial ,10vial/box
epitalon 10mg/vial ,10vial/box
DSIP 2mg/vial ,10vial/box
DSIP 5mg/vial ,10vial/box
selank 2mg/vial ,10vial/box
selank 5mg/vial ,10vial/box
BPC 157 2mg/vial ,10vial/box
Gonadorelin 2mg/vial ,10vial/box
Triptorelin GNRH 2mg/vial ,10vial/box
ghrh 2mg/vial ,10vial/box
Tesamorelin 2mg/vial ,10vial/box
ACE031 1mg/vial ,10vial/box
GDF-8 1mg/vial ,10vial/box

Safe Shipping
Factory Supply Peptides Igf-1des Igf-1lr3 for Muscle Building

Other Steroid Hormone Powder:
Testosterone Acetate Trenbolone Acetate MGF
Testosterone Cypionate Trenbolone Enanthate PEG MGF
Testosterone Decanoate Boldenone Acetate CJC-1295
Testosterone Enanthate Boldenone undecylenate CJC-1295 DAC
Testosterone Isocaproate Boldenone Cypionate PT-141
Testosterone Phenylpropionate Boldenone Propionate Melanotan-1
Testosterone Propionate Nandrolone Decanoate Melanotan-2
Testosterone Undecanoate Nandrolone phenylpropionate GHRP-2
Mesterone Nandrolone undecylate GHRP-6
Testosterone Sustanon 250 Nandrolone cypionate Ipamorelin
Clostebol Acetate Nandrolone propionate Hexarelin
Methylandrostanolone Methyltrienolone Sermorelin
Methenolone Enanthate Drostanolone Propionate Oxytocin
Methenolone Acetate Drostanolone Enanthate TB500
Anadrol Stanolone Fragment 176-191
Anavar Tadalafil Triptorelin
Winstrol Vardenafil Tesamorelin
Clomifene citrate Dianabol Gonadorelin
Toremifene citrate Tamoxifen Citrate DSIP
Finasteride Dapoxetine hydrochloride Selank


Semi-finished Injectable / Oral steroids:
Test prop-----------100mg/ml 200mg/ml
Test enan-----------250mg/ml 300mg/ml 400mg/ml 500mg/ml 600mg/ml
Test cyp------------200mg/ml 250mg/ml 300mg/ml
Test Sustanon-------200mg/ml 250mg/ml 300mg/ml 400mg/ml
Deca----------------200mg/ml 250mg/ml
Equipoise-----------200mg/ml 300mg/ml
Tren ace------------100mg/ml 200mg/ml
Tren enan-----------100mg/ml 200mg/ml
Dianabol------------50mg/ml
Winstrol------------50mg/ml
Masteron------------100mg/ml 150mg/ml
Primobolone---------100mg/ml
Supertest-----------450mg/ml
Anomass ------------400mg/ml
Ripex---------------225mg/ml
Tritren-------------180mg/ml
Tri Test------------300mg/ml
Tri Deca------------300mg/ml
Test Blend----------450mg/ml 500mg/ml
Nandro Test---------225mg/ml
Mass----------------500mg/ml
Cut Depot-----------400mg/ml
Tren Test-----------225mg/ml
Nandro Test Depot---------450mg/ml
Equi Test-----------------450mg/ml
Rip Cut-------------------175mg/ml
Tren Test Depot-----------450mg/ml

 

Peptides
HGH 176-191 2mg/vial 10vials/kit 1g/bag
GHRP-2 5mg/vial 10vials/kit 1g/bag
GHRP-2 10mg/vial 10vials/kit 1g/bag
GHRP-6 5mg/vial 10vials/kit 1g/bag
GHRP-6 10mg/vial 10vials/kit 1g/bag
MGF 2mg/vial 10vials/kit 1g/bag
PEG MGF 2mg/vial 10vials/kit 1g/bag
CJC-1295 with DAC 2mg/vial 10vials/kit 1g/bag
CJC-1295 without DAC 2mg/vial 10vials/kit 1g/bag
PT-141 10mg/vial 10vials/kit 1g/bag
Melanotan-1 10mg/vial 10vials/kit 1g/bag
Melanotan-2 10mg/vial 10vials/kit 1g/bag
Ipamorelin 2mg/vial 10vials/kit 1g/bag
Hexarelin 2mg/vial 10vials/kit 1g/bag
Sermorelin 2mg/vial 10vials/kit 1g/bag
Oxytocin 2mg/vial 10vials/kit 1g/bag
TB500 2mg/vial 10vials/kit 1g/bag
Pentadecapeptide BPC 157 2mg/vial 10vials/kit 1g/bag
Triptorelin 2mg/vial 10vials/kit 1g/bag
Gonadorelin 2mg/vial 10vials/kit 1g/bag
Gonadorelin 10mg/vial 10vials/kit 1g/bag
Tesamorelin 2mg/vial 10vials/kit 1g/bag
DSIP 2mg/vial 10vials/kit 1g/bag
Selank 5mg/vial 10vials/kit 1g/bag

 

Competitive advantages

1 High quality with competitive price
1) Standard: Enterprise Standard
2) All Purity≥98%
3) Manufacturer can provide high quality products with factory price.


2 Fast and safe delivery
1) Sufficient stock&disciplined packing team to make sure prompt and discreet delivery;
2) Experienced and professional logistic agent can provide various transportation ways;
3) Parcel can be sent out in 24 hours after payment. Tracking number available;
4) Customs pass rate ≥99%;

3 After-sale service
Any questions or problems after receiving the product, please feel free to contact us.Problems would be solved immediately.

 

If you are interested in our products, or if you have any questions, please feel free to contact me, I will reply you at soonest time.

Contact Person Tina
Email tina@bioproco.com

 
 
 

 
 

Contact Details
Biopro Chemicals Co., Ltd.

Contact Person: Tina

Send your inquiry directly to us (0 / 3000)