Home Products

Growth Hormone Peptides

Good quality Body Building Steroids for sales
Good quality Body Building Steroids for sales
have cooperated with biopro for years and I was invited to say something here. most professional packing, highest quality and best service!

—— Alexander Gaus

Biopro is awesome!!!!!My representative is very polite and keep me current with new promotions.Their powders I ordered are giving me very good result!

—— Oleg M

You guys are soooo fast communication and good quality. will definitely get back with more orders.

—— susan Rustiguel

I order with biopro for a long time and can say they are more gentle and attentive seller who you can make an order.

—— Holly Shane

The quality is sooo stable while order from your guys these years,it is amazing quality ,I will never change my source cos it bring me good feedback!!

—— Alex Clinton

Growth Hormone Peptides

(98)
China 1Mg / Vial Bodybuilding Growth Peptides Follistatin -344 / Follistatin -315 / Ace -031 factory

1Mg / Vial Bodybuilding Growth Peptides Follistatin -344 / Follistatin -315 / Ace -031

1Mg / Vial Bodybuilding Growth Peptides Follistatin -344 / Follistatin -315 / Ace -031 Follistatin (FST) is a secreted glycoprotein that was first identified as a follicle stimulating hormone inhibiting ... Read More
2017-04-11 14:24:46
China Purity 99% Raw Peptide Powder Lean Body Mass CJC -1295 DAC 5mg / Vial, 2mg / Vial factory

Purity 99% Raw Peptide Powder Lean Body Mass CJC -1295 DAC 5mg / Vial, 2mg / Vial

Purity 99% Raw Peptide Powder Lean Body Mass CJC -1295 DAC 5mg / Vial, 2mg / Vial Basic Details: Product Name: CJC1295 DAC Alias: CJC1295 with DAC Density: 1.45 Type: Immune Function AgentsGrade Classification: ... Read More
2017-04-11 14:24:14
China CAS 86168-78-7 Growth Hormone Peptides Energy Increasing Sermorelin factory

CAS 86168-78-7 Growth Hormone Peptides Energy Increasing Sermorelin

CAS 86168-78-7 Growth Hormone Peptides Energy Increasing Sermorelin 1. Quick Details: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu... Read More
2017-04-11 14:23:35
China GMP Lab Supply Muscle Growth Hormone Peptides Long R3 IGF -1 / IGF -1 LR3 factory

GMP Lab Supply Muscle Growth Hormone Peptides Long R3 IGF -1 / IGF -1 LR3

GMP Lab Supply Muscle Growth Hormone Peptides Long R3 IGF -1 / IGF -1 LR3 Product information: Product name:IGF-1 LR3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place Grade... Read More
2017-04-11 14:22:53
China Bodybuilding Growth Hormone Peptides HGH Fragment 176-191 CAS 221231-10-3 factory

Bodybuilding Growth Hormone Peptides HGH Fragment 176-191 CAS 221231-10-3

Bodybuilding Growth Hormone Peptides HGH Fragment 176-191 CAS 221231-10-3 Description What is Human Growth Hormone (HGH) Fragment 176-191? HGH FRAGMENT 176-191 is a Generic steroid and it's active substande ... Read More
2017-04-11 14:22:19
China CJC -1295 DAC Raw Peptide Powder Fat Loss CJC -1295 Human Growth Steroids with DAC factory

CJC -1295 DAC Raw Peptide Powder Fat Loss CJC -1295 Human Growth Steroids with DAC

CJC-1295 DAC Raw Peptide Powder Fat Loss CJC -1295 Human Growth Steroids with DAC DescriptionCJC-1295 DAC as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 increase growth hormone and ... Read More
2017-04-11 14:21:30
China GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial factory

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 7,372 Da Synonyms: IGF... Read More
2017-04-11 14:20:51
China 99.5% Purity Peptide Raw Powder TB-500 for Muscle Injuries Treatment 2mg/vial, 5mg/vial factory

99.5% Purity Peptide Raw Powder TB-500 for Muscle Injuries Treatment 2mg/vial, 5mg/vial

99.5% Purity Peptide Raw Powder TB-500 for Muscle Injuries Treatment 2mg/vial, 5mg/vial Description TB-500 is a peptide fragment hormone that is primarily used in the treatment of various muscle injuries or ... Read More
2017-04-11 14:20:09
China Male / Female HGH Peptides Bremelanotide PT -141 10mg / vial CAS 189691-06-3 factory

Male / Female HGH Peptides Bremelanotide PT -141 10mg / vial CAS 189691-06-3

Male / Female HGH Peptides Bremelanotide PT -141 10mg / vial CAS 189691-06-3 Description PT-141 (Bremelanotide)was developed from the peptide hormone melanotan II which underwent testing as a sunless tanning ... Read More
2017-04-11 14:17:42
China Healthy Human Growth Hormone Peptides GHRP-2 for Fat Loss 5mg / Vial , CAS158861-67-7 factory

Healthy Human Growth Hormone Peptides GHRP-2 for Fat Loss 5mg / Vial , CAS158861-67-7

Healthy Human Growth Hormone Peptides GHRP-2 for Fat Loss 5mg / Vial , CAS158861-67-7 Description: GHRP-2 (also known as KP 102 or Pralmorelin) is a synthetic hexapeptide Growth Hormone Releasing Peptide (GHRP)... Read More
2017-03-31 14:08:43
Page 1 of 10|< 1 2 3 4 5 6 7 8 9 10 >|